"action" : "rerender" } "event" : "ProductMessageEdit", "context" : "", "event" : "MessagesWidgetCommentForm", { "includeRepliesModerationState" : "false", LITHIUM.MessageBodyDisplay('#bodyDisplay_1', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); ] ', 'ajax'); "context" : "", "context" : "", "actions" : [ { { "message" : "1969725", var clickedDomElement = $(this); ] LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "deleteMessage", "componentId" : "forums.widget.message-view", ","loaderSelector":"#lineardisplaymessageviewwrapper .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "actions" : [ } } "actions" : [ "actions" : [ ] "}); Mit einem anderen Browser probiert? ], "selector" : "#messageview_4", "context" : "", "event" : "MessagesWidgetMessageEdit", } }, Kann jemand mir helfen meinen Internet Vertrag kündigen? "action" : "rerender" } "action" : "rerender" { { "action" : "rerender" $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { }, "displaySubject" : "true", }, "event" : "MessagesWidgetEditAction", "actions" : [ }, "event" : "MessagesWidgetAnswerForm", "context" : "envParam:quiltName,message", "context" : "", { { { "action" : "rerender" ] "eventActions" : [ count++; { "selector" : "#kudosButtonV2_0", }, "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "activecastFullscreen" : false, ] }, ] // Oops. "parameters" : { "initiatorBinding" : true, LITHIUM.AjaxSupport.fromForm('#form_5', 'GiveRating', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { "accessibility" : false, "actions" : [ }, "action" : "addClassName" "action" : "rerender" { { { "action" : "rerender" "disableLinks" : "false", LITHIUM.Cache.CustomEvent.set([{"elementId":"link_8","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1967109}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1969785}},{"elementId":"link_19","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1967270}},{"elementId":"link_23","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1969612}},{"elementId":"link_27","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1969617}},{"elementId":"link_31","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1969725}},{"elementId":"link_36","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1969785}},{"elementId":"link_39","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1423764}}]); { { }, "context" : "envParam:quiltName,product,contextId,contextUrl", "context" : "envParam:quiltName", "actions" : [ "context" : "", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_2","menuItemsSelector":".lia-menu-dropdown-items"}}); "context" : "", })(LITHIUM.jQuery); { "selector" : "#kudosButtonV2_3", }, { "context" : "envParam:quiltName", { }, } "displayStyle" : "horizontal", "event" : "removeThreadUserEmailSubscription", { $(document).ready(function(){ "action" : "rerender" LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234261}); }, "displaySubject" : "true", "truncateBodyRetainsHtml" : "false", }, "action" : "rerender" }); $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); ] count = 0; { "context" : "envParam:entity", }, }, "actions" : [ "context" : "envParam:feedbackData", "ajaxEvent" : "LITHIUM:lightboxRenderComponent", if (element.hasClass('active')) { "actions" : [ }, ', 'ajax'); { "event" : "editProductMessage", ] ] ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "context" : "", }, "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "event" : "MessagesWidgetEditCommentForm", "context" : "envParam:entity", { "context" : "envParam:entity", }, "event" : "deleteMessage", { 02102-986575 . }, "actions" : [ $(this).next().toggle(); "forceSearchRequestParameterForBlurbBuilder" : "false", } "actions" : [ "context" : "envParam:quiltName", "selector" : "#kudosButtonV2_5", "action" : "rerender" { ;(function($) { "actions" : [ "initiatorBinding" : true, $('.lia-autocomplete-footer').append(ctaHTML); }, { "action" : "addClassName" } "action" : "rerender" "action" : "rerender" { }, ] "actions" : [ ], { { "useCountToKudo" : "false", "action" : "rerender" { "actions" : [ count = 0; } { ] ] { } "actions" : [ ], "componentId" : "kudos.widget.button", "includeRepliesModerationState" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_33","feedbackSelector":".InfoMessage"}); }, "actions" : [ ] "context" : "lia-deleted-state", ] return; "actions" : [ "event" : "MessagesWidgetAnswerForm", { "kudosLinksDisabled" : "false", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_2.lineardisplaymessageviewwrapper_0:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/242625","ajaxErrorEventName":"LITHIUM:ajaxError","token":"Ka7jXoTjR83mU7B-pDh2fUGU5eRbwQj1yshUkwJaMcc. "event" : "addMessageUserEmailSubscription", "selector" : "#kudosButtonV2_1", } Leider ist es seit Mondaten nicht mehr möglich, die Daten zu der Partnerkarte (und auch sonstige Optionen) anzuzeigen. '; setCookie: function(cookieName, cookieValue) { "actions" : [ "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", } Ein Postpaid-Handyvertrag von Vodafone hat eine erstmalige Mindestlaufzeit von 24 Monaten. { "useTruncatedSubject" : "true", }); "context" : "envParam:quiltName,expandedQuiltName", } }); "context" : "envParam:quiltName,expandedQuiltName", }, "event" : "addMessageUserEmailSubscription", "useTruncatedSubject" : "true", LITHIUM.StarRating('#any_0_4', true, 2, 'LITHIUM:starRating'); ] "action" : "rerender" }, "event" : "markAsSpamWithoutRedirect", } "action" : "rerender" { LITHIUM.MessageBodyDisplay('#bodyDisplay_5', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] { { "actions" : [ { { "actions" : [ "quiltName" : "ForumMessage", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); "action" : "rerender" "includeRepliesModerationState" : "false", "action" : "rerender" "}); { }, "context" : "", ] "action" : "pulsate" }, "action" : "rerender" }, ] var notifCount = 0; "context" : "envParam:quiltName", "actions" : [ ] "selector" : "#messageview_5", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_29","feedbackSelector":".InfoMessage"}); ] { The owner of the contract talked to you regarding the situation and I was supposed to receive a letter from you to cancel my contract. "actions" : [ LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_5","componentSelector":"#lineardisplaymessageviewwrapper_5","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1969785,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. })(LITHIUM.jQuery); "context" : "", "event" : "MessagesWidgetEditCommentForm", }, } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_17","feedbackSelector":".InfoMessage"}); "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); "actions" : [ "parameters" : { "actions" : [ { { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_27","feedbackSelector":".InfoMessage"}); { "context" : "", "action" : "rerender" { "action" : "rerender" "context" : "", "actions" : [ "}); { }, "context" : "", { "initiatorBinding" : true, "actions" : [ "disableLabelLinks" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_30","feedbackSelector":".InfoMessage"}); "event" : "MessagesWidgetEditAction", "actions" : [ Also was solls. // Set start to true only if the first key in the sequence is pressed } "messageViewOptions" : "1111110111111111111110111110100101101101" "event" : "expandMessage", "event" : "unapproveMessage", { "actions" : [ } ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { { { "message" : "1969617", "context" : "envParam:quiltName,expandedQuiltName", "context" : "", ] "activecastFullscreen" : false, "action" : "rerender" }, }, LITHIUM.Tooltip({"bodySelector":"body#lia-body","delay":30,"enableOnClickForTrigger":false,"predelay":10,"triggerSelector":"#link_68831e97c88bfc","tooltipContentSelector":"#link_68831e97c88bfc_0-tooltip-element .content","position":["bottom","left"],"tooltipElementSelector":"#link_68831e97c88bfc_0-tooltip-element","events":{"def":"focus mouseover,blur mouseout"},"hideOnLeave":true}); "event" : "expandMessage", }, ] "action" : "pulsate" LITHIUM.AjaxSupport.ComponentEvents.set({ { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "parameters" : { event.preventDefault(); LITHIUM.StarRating('#any_2', false, 1, 'LITHIUM:starRating'); "useCountToKudo" : "false", "context" : "", } "event" : "addMessageUserEmailSubscription", LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); "action" : "rerender" })(LITHIUM.jQuery); }); "event" : "MessagesWidgetMessageEdit", "}); { } "action" : "rerender" { { } LITHIUM.StarRating('#any_6', false, 1, 'LITHIUM:starRating'); { { "context" : "lia-deleted-state", }, } { $('.css-menu').removeClass('cssmenu-open') LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/Archiv_Mobilfunk/thread-id/242625","ajaxErrorEventName":"LITHIUM:ajaxError","token":"ppf9GTkvO8kUzLLEagZrB6M78RWkEF3ECJqtx7fgqFs. }, "truncateBodyRetainsHtml" : "false", }); "action" : "rerender" "context" : "lia-deleted-state", "parameters" : { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1969617 .lia-rating-control-passive', '#form_3'); "event" : "ProductMessageEdit", "actions" : [ { "event" : "MessagesWidgetMessageEdit", "entity" : "1969617", }, "eventActions" : [ "actions" : [ }, LITHIUM.AjaxSupport.ComponentEvents.set({ ] } }, "displaySubject" : "true", ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "ProductMessageEdit", "action" : "rerender" { }, "initiatorDataMatcher" : "data-lia-kudos-id" { "event" : "ProductMessageEdit", ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/Archiv_Mobilfunk/thread-id/242625","ajaxErrorEventName":"LITHIUM:ajaxError","token":"ppf9GTkvO8kUzLLEagZrB6M78RWkEF3ECJqtx7fgqFs. "disableLinks" : "false", Bist du sicher, dass du fortfahren möchtest? { }else{ "eventActions" : [ ] ] })(LITHIUM.jQuery); "actions" : [ } "closeImageIconURL" : "https://forum.vodafone.de/skins/images/767B9E5D691D46035B0CB025156F3D71/responsive_peak/images/button_dialog_close.svg", "context" : "envParam:quiltName", if ( neededkeys[count] == key ) { "disableLinks" : "false", } $('div[class*="-menu-btn"]').removeClass('active'); }, "actions" : [ "selector" : "#kudosButtonV2_3", { "showCountOnly" : "false", "context" : "envParam:quiltName,message,product,contextId,contextUrl", }, "context" : "", "initiatorDataMatcher" : "data-lia-message-uid" "disableLabelLinks" : "false", "context" : "", "useSimpleView" : "false", }, "event" : "MessagesWidgetEditCommentForm", }, { "action" : "rerender" { Bist du sicher, dass du fortfahren möchtest? "selector" : "#messageview_0", ;(function($) { LITHIUM.StarRating('#any_6', false, 1, 'LITHIUM:starRating'); var watching = false; }, "disallowZeroCount" : "false", }, }, ] "context" : "", "context" : "envParam:quiltName,product,contextId,contextUrl", "event" : "removeThreadUserEmailSubscription", { "action" : "rerender" "action" : "rerender" /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/

Kinder Aquarium Komplett-set, Metzgerei Müller Kornburg, Snack Am Eck Hammelburg Speisekarte, Abschreibung Immobilien Eigennutzung, Zdf Mediathek Traumschiff Kapstadt, Anderes Wort Für Erzielt, Heide Keller Bruder, New Yorker Lions 2, Deitermann Datteln Unfall, Kindern Spielerisch Wissen Vermitteln, Sorry To Bother Deutsch,